"context" : "envParam:selectedMessage", Shop now V-Pet Tracker by Vodafone. "action" : "rerender" "event" : "approveMessage", Damit buchen Sie für einmalig 2,99 EUR das Highspeed-Paket von 1&1 und somit weitere 500 MB. { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "", "action" : "rerender" } }, }); { ] "actions" : [ }); Buchen Sie zusätzliches Highspeed-Volumen: Einmalig - 1&1 Highspeed-Pakete: Buchung eines oder mehrerer Pakete. count = 0; "action" : "rerender" } "actions" : [ } "actions" : [ } })(LITHIUM.jQuery); // Pull in global jQuery reference { "context" : "", hast Du es mit der SMS nochmal zu einem späteren Zeitpunkt versucht? { "linkDisabled" : "false" "action" : "rerender" } "truncateBody" : "true", Du bekommst je nach Tarif … LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_12e0cba708b33b', 'enableAutoComplete', '#ajaxfeedback_12e0cba708b33b_0', 'LITHIUM:ajaxError', {}, 'm5ta6DJ1rhi-otxBoDlMXpcByQjRqt1fCcJ5bDzmwHE. "event" : "MessagesWidgetAnswerForm", { ] { "}); ] "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $('#node-menu li.has-sub>a').on('click', function(){ ] "actions" : [ { }, ] LITHIUM.AjaxSupport.ComponentEvents.set({ "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } { "linkDisabled" : "false" { } { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "event" : "addMessageUserEmailSubscription", ] "actions" : [ "event" : "markAsSpamWithoutRedirect", ] "truncateBody" : "true", }, ] ] Twitter; Vodafone Business Vodafone Internet of Things Carrier Services Twitter Vodafone Business Vodafone Internet of Things Carrier Services LinkedIn. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_12e0cba708b33b_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, Vodafone Group Plc. "actions" : [ "event" : "expandMessage", }); { "action" : "rerender" { { // Reset the conditions so that someone can do it all again. "action" : "rerender" "event" : "removeThreadUserEmailSubscription", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "useCountToKudo" : "false", "}); "action" : "rerender" } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.Dialog.options['219098908'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "event" : "deleteMessage", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); Bist du sicher, dass du fortfahren möchtest? "truncateBodyRetainsHtml" : "false", { $('#vodafone-community-header .lia-search-input-wrapper').hide(); "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.ComponentEvents.set({ })(LITHIUM.jQuery); }, LITHIUM.Dialog.options['219098908'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "event" : "editProductMessage", Vodafone B528s-23a. { })(LITHIUM.jQuery); "disableLinks" : "false", }); }, Auch ich bekomme regelmäßig jeden Monat eine Email, das mein Datenvolumen verbraucht sei. "action" : "rerender" If you joined Vodafone bill pay before 11th October 2016 you are not eligible for Network Satisfaction Guarantee. { "context" : "", "event" : "expandMessage", Vodafone CX6V. }, { ] "event" : "ProductMessageEdit", } { "activecastFullscreen" : false, Senden Sie dazu eine SMS an 70997. "selector" : "#kudosButtonV2_1", Nach erfolgreicher Buchung steht dann für den restlichen Monat 1 GB zusätzliches Datenvolumen in LTE-Geschwindigkeit zur Verfügung. "action" : "pulsate" "disableLabelLinks" : "false", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }, "action" : "rerender" "event" : "RevokeSolutionAction", Vodafone Smart N10 4G. { "selector" : "#messageview_1", 18.12.2020, 17:11 Uhr 66 . $(this).toggleClass("view-btn-open view-btn-close"); // console.log(key); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "context" : "", { ', 'ajax'); "initiatorDataMatcher" : "data-lia-kudos-id" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" { }; ;(function($) { Rádi vám o sobě řekneme více. 12.08.2018 10:11 : ist irgend wie nicht vollständig : 31.10.2017 19:14 : Verkauf : sendet eine SMS, mein Datenvolumen wäre fast aufgebraucht und ich soll eine Hamburger Festnetz-Nummer anrufen zwecks Zubuchung. "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" ] "actions" : [ { }, ] Vodafone, telecommunications company based in the United Kingdom with interests in Europe and the United States. { "action" : "rerender" { "action" : "rerender" }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswer", } "event" : "RevokeSolutionAction", { { } { { "selector" : "#messageview_1", { "event" : "MessagesWidgetEditAnswerForm", "eventActions" : [ } "useTruncatedSubject" : "true", ] "context" : "", { The Connection, Newbury, Berkshire RG14 2FN. }, }); Dann sende eine SMS mit "Langsam" an 70997. "context" : "", // console.log(key); } ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); Keep tabs on your pet and monitor their health with advanced fitness tracking . "useSimpleView" : "false", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } $('section.header-announcement').slideUp(); "action" : "rerender" ] "linkDisabled" : "false" "event" : "unapproveMessage", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "selector" : "#messageview_0", Hallo Ich habe ein galaxy s7 edge, es kam die meldung: Datenvolumen verbraucht bitte nachbuchen. ] Wir begrenzen Ihre Surfgeschwindigkeit auf 64 kbit/s. Fazit: ist keine Easybox dazwischengeschaltet (also man surft direkt mit dem Stick) kann man zwar eine SMS von Vodafone über den Verbrauch erhalten mit dem Hinweis, daß man Datenvolumen hinzubuchen kann, will man aber dann die Buchung per SMS durchführen, klappt dies wohl nicht; es sei denn, die SMS-Nr. LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_12e0cba708b33b', 'enableAutoComplete', '#ajaxfeedback_12e0cba708b33b_0', 'LITHIUM:ajaxError', {}, 'm5ta6DJ1rhi-otxBoDlMXpcByQjRqt1fCcJ5bDzmwHE. "useSimpleView" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "action" : "rerender" } lithadmin: [] "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234710}); "event" : "MessagesWidgetMessageEdit", "componentId" : "forums.widget.message-view", "quiltName" : "ForumMessage", var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); ] "useTruncatedSubject" : "true", "action" : "addClassName" "event" : "unapproveMessage", { "event" : "QuickReply", }, logmein: [76, 79, 71, 77, 69, 73, 78], "defaultAriaLabel" : "", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "actions" : [ } "actions" : [ { "actions" : [ ], { // Set start to true only if the first key in the sequence is pressed .attr('aria-expanded','true') "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "event" : "editProductMessage", "context" : "envParam:quiltName,message", }); { "initiatorDataMatcher" : "data-lia-kudos-id" Samsung Galaxy S10 Plus. Klick dazu auf die Highspeed-Volumen-Anzeige. var resetMenu = function() { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); ], 3 GB kosten 14,99 Euro im Monat. { { { Kommentar. ] LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "event" : "MessagesWidgetCommentForm", "event" : "expandMessage", { "actions" : [ "disableLabelLinks" : "false", ] "actions" : [ "kudosLinksDisabled" : "false", "disableLabelLinks" : "false", Phone numbers. }, } "event" : "addThreadUserEmailSubscription", "action" : "rerender" } LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "context" : "", if ( key == neededkeys[0] ) { Comenzile cu plata în rate pot conţine un singur produs. } lithadmin: [] { "event" : "approveMessage", "revokeMode" : "true", } 122.40 EUR. { "action" : "rerender" { { } "actions" : [ } { // enable redirect to login page when "logmein" is typed into the void =) { ] LITHIUM.Dialog({ }, { Dank otelo-ComputerBILD-Aktion gibt’s über gethandy die otelo Allnet-Flat Classic aktionsweise mit 10 GB LTE-Datenvolumen (statt 7 GB) im Vodafone-Netz für monatlich 19,99 € − was ja einem Daten-Mehr von 2 GB pro Monat entspricht. "truncateBodyRetainsHtml" : "false", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Read our policy, No thanks, I want to stay on Vodafone.com, M-mama: connecting pregnant women with emergency care in Africa, Vodafone named top 25 global corporate for working with start-ups, Tech companies can help create a sustainable future, How our F-LANE start-ups are supporting digital transformation in Africa, Vodafone recognised by CDP with ‘A’ score for climate change actions and transparency, Enabling customers to reduce their emissions. "event" : "ProductAnswerComment", Browse with Vodafone Fibre, with guaranteed speeds and unlimited bandwidth. ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. Vodafone B3000. }, ] { "context" : "", "event" : "kudoEntity", Ano Ne. "action" : "pulsate" ctaHTML += "Lösung noch nicht gefunden? ', 'ajax'); { "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_12e0cba708b33b_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" }, LITHIUM.AjaxSupport.ComponentEvents.set({ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ if (element.hasClass('active')) { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "componentId" : "forums.widget.message-view", Registered in England No 1833679, We use cookies to improve your experience on this site. "action" : "rerender" "context" : "", { ] } "action" : "rerender" }, }, "event" : "expandMessage", "}); // We made it! ] Bist du sicher, dass du fortfahren möchtest? { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1320080}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1321763}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1322022}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1678415}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":416192}}]); "actions" : [ ] })(LITHIUM.jQuery); "kudosable" : "true", } ] Hat es dann geklappt? "activecastFullscreen" : false, // Oops. "closeEvent" : "LITHIUM:lightboxCloseEvent", ] { // Oops, not the right sequence, lets restart from the top. "actions" : [ "context" : "", }, "action" : "rerender" Schicken Sie zum Buchen eine SMS mit "1". { Dabei habe ich erst 11 % meines Datenvolumens verbraucht. "event" : "MessagesWidgetCommentForm", "context" : "", "action" : "rerender" .attr('aria-selected','false'); "componentId" : "kudos.widget.button", Frage zu umts und 5gb fairuse - Forum UMTS/GPRS, WiMax, LTE und Satellit "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { })(LITHIUM.jQuery); }, Telephone Enjoy calls at 0 cents and call whoever you like. "actions" : [ "disableLabelLinks" : "false", } element.children('ul').slideDown(); }, "event" : "unapproveMessage", ] }); }, LITHIUM.Dialog({ }; "context" : "", { "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); }, $(this).toggleClass('active'); Pana la 250 (4) Culoare. //if(height > 430) { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { }, }, "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetEditCommentForm", LinkedIn ; Vodafone Business Vodafone Cloud and Hosting Vodafone Internet of Things Vodafone Carrier Services …