] { { "truncateBody" : "true", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "addMessageUserEmailSubscription", "event" : "markAsSpamWithoutRedirect", { "truncateBodyRetainsHtml" : "false", { { "action" : "rerender" }, "context" : "envParam:selectedMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", ;(function($){ } { ] "event" : "editProductMessage", "actions" : [ { }, { "event" : "MessagesWidgetEditCommentForm", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'wyJr9roVzwZKdEky9qBhOvMidZ8oz4IVypNIefAIe5I. "context" : "", "actions" : [ "context" : "envParam:quiltName", }, //$(window).scroll(function() { "event" : "ProductAnswer", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "deleteMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { { { "kudosable" : "true", "event" : "approveMessage", "useTruncatedSubject" : "true", // We made it! } "event" : "MessagesWidgetMessageEdit", document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); } } } { "actions" : [ ] count = 0; ] "}); "selector" : "#kudosButtonV2_1", { LITHIUM.Dialog.options['388091963'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ Liegt keine Playlist vor, müssen die Sender einzeln in den Player eingearbeitet werden. "buttonDialogCloseAlt" : "Schließen", { "context" : "", $(document).ready(function(){ }(LITHIUM.jQuery)); { "initiatorDataMatcher" : "data-lia-message-uid" Beste IPTV Anbieter m3u Server. { "event" : "ProductMessageEdit", } "displayStyle" : "horizontal", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); } "entity" : "2058758", "triggerEvent" : "click", } } }, return; { { { "event" : "kudoEntity", "context" : "envParam:quiltName", { { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { "revokeMode" : "true", { "showCountOnly" : "false", { "actions" : [ LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_2cd3e022c9658c', 'enableAutoComplete', '#ajaxfeedback_2cd3e022c9658c_0', 'LITHIUM:ajaxError', {}, 'vKi3PuhY4ZqRTnjDq4cHVIl5LLPf1D-VaR3xM7VluZA. { "quiltName" : "ForumMessage", "message" : "2059717", "actions" : [ }, "action" : "rerender" "useSimpleView" : "false", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2053068}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058758}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2054408}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058758}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059717}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2501494}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2501131}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497626}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2484681}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505818}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506820}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506551}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506499}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506454}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506211}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506079}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506035}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505943}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505857}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505752}}]); "event" : "kudoEntity", { "event" : "ProductMessageEdit", }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I_cHqa-bNy08Fh9t_HF_w9qUHbOHXGLeWjV39R5Ic4g. }, "action" : "addClassName" "eventActions" : [ LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "truncateBody" : "true", "includeRepliesModerationState" : "false", } }, return; } }, }, }, "initiatorDataMatcher" : "data-lia-kudos-id" { } lithadmin: [] "context" : "envParam:quiltName,expandedQuiltName", var clickedDomElement = $(this); "event" : "MessagesWidgetEditAction", { "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", funktionieren seit einigen Tagen nicht mehr an meinem Vodafone TV IPTV Anschluss. } "context" : "", "context" : "", // enable redirect to login page when "logmein" is typed into the void =) return; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ', 'ajax'); "context" : "", "context" : "", { "actions" : [ { { "parameters" : { count = 0; Bosnia IPTV | Premium IPTV | 4K & Full HD & SD Sendung | Aktuelle Serien, Kino | Kompatibel Mit Allen Geräten | 24 Stunden kostenloser test } else { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" if ( key == neededkeys[0] ) { "floatedBlock" : "acceptedSolutions", "context" : "lia-deleted-state", ] "context" : "envParam:quiltName,expandedQuiltName", "action" : "pulsate" ] }, "context" : "envParam:selectedMessage", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; var position_x = msg.offset(); "actions" : [ "context" : "", { ] "event" : "QuickReply", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "context" : "lia-deleted-state", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "parameters" : { { { }); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "messageViewOptions" : "1111110111111111111110111110100101101101" "action" : "rerender" element.addClass('active'); if ( watching ) { "event" : "expandMessage", ;(function($) { "action" : "rerender" "context" : "", }, "closeEvent" : "LITHIUM:lightboxCloseEvent", }, "actions" : [ "disableLinks" : "false", "useCountToKudo" : "false", "context" : "envParam:feedbackData", "actions" : [ "context" : "envParam:quiltName", } "event" : "expandMessage", "action" : "rerender" "context" : "", { "event" : "addThreadUserEmailSubscription", "event" : "kudoEntity", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ], In unserem Beispiel nutzen wir ein sehr einfaches Addon. "forceSearchRequestParameterForBlurbBuilder" : "false", } "accessibility" : false, "context" : "", }, Dank IP-TV klappt das vielerorts übers Internet. "event" : "addThreadUserEmailSubscription", { $(document).keydown(function(e) { "action" : "rerender" }); "event" : "approveMessage", "actions" : [ "event" : "approveMessage", } ] //var height = $(window).scrollTop(); LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, (Tipp ursprünglich verfasst von: Marcel Peters ). Dazu müssen Sie mit den Pfeiltasten auf Ihrer Fernbedienung die verschiedenen Frequenzbereiche durchsuchen. LITHIUM.Loader.runJsAttached(); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ }, "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); ] ], "event" : "MessagesWidgetCommentForm", "event" : "unapproveMessage", "actions" : [ Beispielsweise bieten die meisten privaten TV-Sender ihre Inhalte nicht kostenlos über IPTV an. { ], "event" : "RevokeSolutionAction", "initiatorBinding" : true, ] "useSimpleView" : "false", "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "action" : "rerender" "event" : "expandMessage", "truncateBodyRetainsHtml" : "false", "event" : "approveMessage", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "event" : "editProductMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ;(function($) { "useSubjectIcons" : "true", }, { } { "displaySubject" : "true", var keycodes = { lithadmin: [] Ohne Anmeldung und super einfach, volles Programm auf den Geräten Ihrer Wahl. "context" : "", "action" : "rerender" }, "actions" : [ "}); "actions" : [ ctaHTML += 'Stell Deine Frage'; "useSimpleView" : "false", }); { "kudosable" : "true", Dank Online-Fernsehen oder Internet-TV ist es möglich, TV-Sender bequem über die Internetleitung zu empfangen. { "initiatorBinding" : true, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "context" : "", "event" : "ProductAnswer", "context" : "envParam:feedbackData", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }, "messageViewOptions" : "1111110111111111111110111110100101001101" .attr('aria-expanded','false'); "actions" : [ Wie kann ich das machen? The official Smart IPTV Facebook page has been unpublished due to many page clones available. "actions" : [ "message" : "2058758", "}); "context" : "", "context" : "", "actions" : [ "actions" : [ ] { "actions" : [ { { }, "action" : "pulsate" { "actions" : [ { LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); } if ( neededkeys[count] == key ) { Attention! "actions" : [ "useSubjectIcons" : "true", Bäche waren glatt und fehlerlos. "eventActions" : [ "message" : "2054408", "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "forceSearchRequestParameterForBlurbBuilder" : "false", }; } { } "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2058758 .lia-rating-control-passive', '#form_2'); "context" : "", } So, und weils oft so hakt, habe ich keine URL als Stream in den IPTV Einstellung eingefügt, sondern direkt eine mu3 Datei, also Lokal gespeichert. "event" : "approveMessage", ] Das sind die Sender, die du frei über IPTV bekommst. "context" : "", "actions" : [ }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276","ajaxErrorEventName":"LITHIUM:ajaxError","token":"l76hyX9XpqsCaIYeVDpkpIJOqTY8_BQQfB8gxK4RrDg. { "actions" : [ "event" : "AcceptSolutionAction", } "action" : "rerender" } ] "actions" : [ "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "}); notifCount = parseInt($(this).html()) + notifCount; } "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetAnswerForm", count = 0; }, "event" : "removeThreadUserEmailSubscription", }, Für Links auf dieser Seite erhält CHIP ggf. } { Bist du sicher, dass du fortfahren möchtest? "action" : "pulsate" ] }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); } event.preventDefault(); { Bist du sicher, dass du fortfahren möchtest? LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'Ve4ETiQ989PfJ5GPmft6wsuFvJW_8S8KKjOWPx16bR4. Januar 2017 #1 Habe bei keinem einzigen funktionierenden IPTV-Stream einen Ton. $(this).addClass('active') "event" : "addThreadUserEmailSubscription", "context" : "", ', 'ajax'); "action" : "rerender" ] ] "event" : "MessagesWidgetEditAction", ], "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233493}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "actions" : [ "actions" : [ eine Provision vom Händler, z.B. }, })(LITHIUM.jQuery); }, { } { "actions" : [ { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "selector" : "#messageview_3", }, "linkDisabled" : "false" "context" : "", "event" : "ProductAnswerComment", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" var key = e.keyCode; "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] ] { } "action" : "rerender" { ] "event" : "addMessageUserEmailSubscription", "context" : "", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] var cookieDomain = 'forum.vodafone.de'; "context" : "envParam:entity", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference { "context" : "", } } "event" : "unapproveMessage", ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "context" : "", })(LITHIUM.jQuery); ] Alles weitere, was du über irgendeine m3u-Playlist angezeigt bekommst, ist so einfach nicht legal und auch das wird hier nicht supported. "selector" : "#kudosButtonV2_3", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "addMessageUserEmailSubscription", }, } "context" : "", "disableLabelLinks" : "false", }, "context" : "envParam:feedbackData", } }, // --> var clickHandler = function(event) { { { { ] $('.community-menu').removeClass('active') } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", "revokeMode" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { { "action" : "rerender" count++; "action" : "rerender" Ich bin sehr zufrieden mit ihrem Service. ] { }, } "action" : "rerender" ] "useSubjectIcons" : "true", Wenn du einzelne Sender nicht über deinen IPTV-Anschluss empfangen kannst oder für diese keine Freischaltung erhälst, prüfe bitte zunächst, ob die Sender in deinem Abonnement enthalten sind. ] { //$('#vodafone-community-header').css('display','block'); $(document).ready(function(){ }, { } "truncateBody" : "true", "action" : "rerender" "disableLinks" : "false", { "action" : "rerender" "context" : "", Im Großen und Ganzen bin ich leider eher unzufrieden. "context" : "envParam:feedbackData", "actions" : [ "action" : "rerender" "action" : "rerender" "event" : "unapproveMessage", }, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "truncateBodyRetainsHtml" : "false", { LITHIUM.Dialog.options['-1872745393'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};